PDB entry 2tgf

View 2tgf on RCSB PDB site
Description: the solution structure of human transforming growth factor alpha
Class: growth factor
Keywords: growth factor
Deposited on 1991-01-23, released 1993-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transforming growth factor-alpha
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01135 (0-49)
  Domains in SCOPe 2.08: d2tgfa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2tgfA (A:)
  vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla