PDB entry 2tgd

View 2tgd on RCSB PDB site
Description: lack of the transition state stabilization site is a factor in the inactivity of trypsinogen, a serine protease zymogen. structure of dfp inhibited bovine trypsinogen at 2.1 angstroms resolution
Class: hydrolase zymogen (serine proteinase)
Keywords: hydrolase zymogen (serine proteinase)
Deposited on 1986-03-17, released 1986-05-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsinogen
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2tgda_
  • Heterogens: CA, DFP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2tgdA (A:)
    vddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedn
    invvegneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagt
    qclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscq
    gdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tgdA (A:)
    vggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvvegn
    eqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgw
    gntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpv
    vcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn