PDB entry 2tci

View 2tci on RCSB PDB site
Description: x-ray crystallographic studies on hexameric insulins in the presence of helix-stabilizing agents, thiocyanate, methylparaben and phenol
Deposited on 1995-09-13, released 1996-01-29
The last revision prior to the SCOP 1.59 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1975
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d2tci.1
  • Chain 'B':
    Domains in SCOP 1.59: d2tci.1
  • Chain 'C':
    Domains in SCOP 1.59: d2tci.2
  • Chain 'D':
    Domains in SCOP 1.59: d2tci.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2tciA (A:)
giveqcctsicslyqlenycn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2tciB (B:)
vnqhlcgshlvealylvcgergffytpk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2tciC (C:)
giveqcctsicslyqlenycn

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2tciD (D:)
fvnqhlcgshlvealylvcgergffytpka