PDB entry 2tci
View 2tci on RCSB PDB site
Description: x-ray crystallographic studies on hexameric insulins in the presence of helix-stabilizing agents, thiocyanate, methylparaben and phenol
Deposited on
1995-09-13, released
1996-01-29
The last revision prior to the SCOP 1.57 freeze date was dated
1996-01-29, with a file datestamp of
1996-01-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1975
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Domains in SCOP 1.57: d2tci.1 - Chain 'B':
Domains in SCOP 1.57: d2tci.1 - Chain 'C':
Domains in SCOP 1.57: d2tci.2 - Chain 'D':
Domains in SCOP 1.57: d2tci.2
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2tciA (A:)
giveqcctsicslyqlenycn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2tciB (B:)
vnqhlcgshlvealylvcgergffytpk
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2tciC (C:)
giveqcctsicslyqlenycn
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>2tciD (D:)
fvnqhlcgshlvealylvcgergffytpka