PDB entry 2tbs

View 2tbs on RCSB PDB site
Description: cold-adaption of enzymes: structural comparison between salmon and bovine trypsins
Class: hydrolase(serine proteinase)
Keywords: hydrolase(serine proteinase)
Deposited on 1994-01-14, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.12
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Salmo salar [TaxId:8030]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35031 (0-221)
      • conflict (12)
      • conflict (131)
      • conflict (148)
      • conflict (211)
    Domains in SCOPe 2.07: d2tbsa_
  • Heterogens: CA, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2tbsA (A:)
ivggyeckaysqahqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsdklqclnipilsysdcndsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifsdwltstmasy