PDB entry 2tbd

View 2tbd on RCSB PDB site
Description: sv40 t antigen DNA-binding domain, nmr, 30 structures
Class: DNA-binding protein
Keywords: replication, origin-binding domain, DNA-binding protein, early protein, acetylation, nuclear protein
Deposited on 1997-01-09, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sv40 t antigen
  Species: Simian virus 40 [TaxId:10633]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03070 (2-131)
  Domains in SCOPe 2.08: d2tbda1, d2tbda2, d2tbda3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2tbdA (A:)
  gskvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhn
  synhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieesl
  pgglkehdfnpess