PDB entry 2sxl

View 2sxl on RCSB PDB site
Description: sex-lethal rbd1, nmr, minimized average structure
Class: RNA-binding domain
Keywords: RNA-BINDING DOMAIN, ALTERNATIVE SPLICING, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 1997-07-16, released 1998-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sex-lethal protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: SEX-LETHAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19339 (0-87)
      • engineered (44)
    Domains in SCOPe 2.08: d2sxla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sxlA (A:)
    asntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqr
    aikvlngitvrnkrlkvsyarpggesik