PDB entry 2stw

View 2stw on RCSB PDB site
Description: solution nmr structure of the human ets1/DNA complex, restrained regularized mean structure
Class: DNA binding protein/DNA
Keywords: complex (DNA-binding protein/DNA), proto-oncogene, DNA-binding, nuclear protein, phosphorylation, DNA binding protein/DNA complex
Deposited on 1996-08-05, released 1997-03-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ets1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2stwa_
  • Chain 'B':
    Compound: DNA (5'-d(*tp*cp*gp*ap*gp*cp*cp*gp*gp*ap*ap*gp*tp*tp*cp*gp*a)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*tp*cp*gp*ap*ap*cp*tp*tp*cp*cp*gp*gp*cp*tp*cp*gp*a)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2stwA (A:)
    vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
    nkpkmnyeklsrglryyydkniihktagkryvyrfv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.