PDB entry 2stw

View 2stw on RCSB PDB site
Description: solution nmr structure of the human ets1/DNA complex, restrained regularized mean structure
Class: DNA binding protein/DNA
Keywords: complex (DNA-binding protein/DNA), proto-oncogene, DNA-binding, nuclear protein, phosphorylation, DNA binding protein/DNA complex
Deposited on 1996-08-05, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ets1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14921 (0-95)
  Domains in SCOPe 2.08: d2stwa_
• Chain 'B':
  Compound: DNA (5'-d(*tp*cp*gp*ap*gp*cp*cp*gp*gp*ap*ap*gp*tp*tp*cp*gp*a)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*tp*cp*gp*ap*ap*cp*tp*tp*cp*cp*gp*gp*cp*tp*cp*gp*a)-3')
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2stwA (A:)
  vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
  nkpkmnyeklsrglryyydkniihktagkryvyrfv
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.