PDB entry 2stb
View 2stb on RCSB PDB site
Description: anionic salmon trypsin in complex with squash seed inhibitor (cucurbita pepo trypsin inhibitor II)
Class: hydrolase/hydrolase inhibitor
Keywords: serine proteinase, trypsin inhibitor, hydrolase/hydrolase inhibitor complex
Deposited on
1998-12-11, released
2000-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'E':
Compound: protein (trypsin)
Species: Salmo salar [TaxId:8030]
Database cross-references and differences (RAF-indexed):
- Uniprot P35031 (0-221)
- conflict (8)
- conflict (12)
Domains in SCOPe 2.08: d2stbe_ - Chain 'I':
Compound: protein (trypsin inhibitor)
Species: Cucurbita pepo [TaxId:3663]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2stbi_ - Heterogens: CA, HOH
PDB Chain Sequences:
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>2stbE (E:)
ivggyeckpysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>2stbI (I:)
rvcpkilmeckkdsdclaeciclehgycg