PDB entry 2sta

View 2sta on RCSB PDB site
Description: anionic salmon trypsin in complex with squash seed inhibitor (cucurbita maxima trypsin inhibitor I)
Class: hydrolase/hydrolase inhibitor
Keywords: serine proteinase, trypsin inhibitor
Deposited on 1998-12-10, released 2000-01-19
The last revision prior to the SCOP 1.75 freeze date was dated 2000-01-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: protein (trypsin)
    Species: Salmo salar
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35031 (0-221)
      • conflict (8)
      • conflict (12)
    Domains in SCOP 1.75: d2stae_
  • Chain 'I':
    Compound: protein (trypsin inhibitor)
    Species: Cucurbita maxima
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2stai_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2staE (E:)
ivggyeckpysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2staI (I:)
rvcprilmeckkdsdclaecvclehgycg