PDB entry 2sta

View 2sta on RCSB PDB site
Description: anionic salmon trypsin in complex with squash seed inhibitor (cucurbita maxima trypsin inhibitor i)
Deposited on 1998-12-10, released 2000-01-19
The last revision prior to the SCOP 1.69 freeze date was dated 2000-01-19, with a file datestamp of 2000-01-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.69: d2stae_
  • Chain 'I':
    Domains in SCOP 1.69: d2stai_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2staE (E:)
ivggyeckpysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2staI (I:)
rvcprilmeckkdsdclaecvclehgycg