PDB entry 2ssp

View 2ssp on RCSB PDB site
Description: leucine-272-alanine uracil-DNA glycosylase bound to abasic site-containing DNA
Class: protein/DNA
Keywords: DNA glycosylase, DNA base excision repair, uracil, DNA, protein/DNA, abasic site
Deposited on 1999-04-28, released 1999-05-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.184
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*cp*tp*gp*tp*(aab)p*ap*tp*cp*tp*t)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*ap*ap*ap*gp*ap*tp*ap*ap*cp*ap*g)-3')
  • Chain 'E':
    Compound: protein (uracil-DNA glycosylase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2sspe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2sspE (E:)
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpspasvyrgffgcrhfsktnellqksgkkpidwkel