PDB entry 2ssp

View 2ssp on RCSB PDB site
Description: leucine-272-alanine uracil-dna glycosylase bound to abasic site-containing dna
Deposited on 1999-04-28, released 1999-05-06
The last revision prior to the SCOP 1.71 freeze date was dated 1999-05-06, with a file datestamp of 1999-05-05.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.184
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.71: d2sspe_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sspE (E:)
    meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
    lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
    llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
    hvlqtahpspasvyrgffgcrhfsktnellqksgkkpidwkel