PDB entry 2src

View 2src on RCSB PDB site
Description: crystal structure of human tyrosine-protein kinase c-src, in complex with amp-pnp
Class: tyrosine-protein kinase
Keywords: src, tyrosine-protein kinase, phosphorylation, sh2, sh3, phosphotyrosine, proto-oncogene, phosphotransferase
Deposited on 1998-12-29, released 1999-07-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.226
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein kinase src
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (Start-451)
      • modified residue (445)
    Domains in SCOPe 2.03: d2srca1, d2srca2, d2srca3
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2srcA (A:)
    mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdawe
    ipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhek
    lvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermn
    yvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrfti
    ksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrk
    epeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2srcA (A:)
    ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi
    qaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhyk
    irkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdaweip
    reslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrheklv
    qlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermnyv
    hrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrftiks
    dvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkep
    eerptfeylqafledyftstepqyqpgenl