PDB entry 2src

View 2src on RCSB PDB site
Description: crystal structure of human tyrosine-protein kinase c-src, in complex with amp-pnp
Deposited on 1998-12-29, released 1999-07-22
The last revision prior to the SCOP 1.57 freeze date was dated 1999-07-22, with a file datestamp of 1999-07-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.226
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2src_ (-)
    ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi
    qaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhyk
    irkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdaweip
    reslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrheklv
    qlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermnyv
    hrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrftiks
    dvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkep
    eerptfeylqafledyftstepqyqpgenl