PDB entry 2sqc

View 2sqc on RCSB PDB site
Description: squalene-hopene cyclase from alicyclobacillus acidocaldarius
Class: isomerase
Keywords: isomerase, triterpene cyclase, monotopic membrane protein, qw-sequence, repeat, cholesterol biosynthesis
Deposited on 1998-08-02, released 1999-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.153
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: squalene-hopene cyclase
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33247
      • engineered (375)
      • engineered (434)
    Domains in SCOPe 2.07: d2sqca1, d2sqca2
  • Chain 'B':
    Compound: squalene-hopene cyclase
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33247
      • engineered (375)
      • engineered (434)
    Domains in SCOPe 2.07: d2sqcb1, d2sqcb2
  • Heterogens: C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2sqcA (A:)
    maeqlveapayartldraveyllscqkdegywwgpllsnvtmeaeyvllchildrvdrdr
    mekirryllheqredgtwalypggppdldttieayvalkyigmsrdeepmqkalrfiqsq
    ggiessrvftrmwlalvgeypwekvpmvppeimflgkrmplniyefgswaratvvalsiv
    msrqpvfplperarvpelyetdvpprrrgakggggwifdaldralhgyqklsvhpfrraa
    eiraldwllerqagdgswggiqppwfyalialkildmtqhpafikgweglelygveldyg
    gwmfqasispvwdtglavlalraaglpadhdrlvkagewlldrqitvpgdwavkrpnlkp
    ggfafqfdnvyypdvcdtavvvwalntlrlpderrrrdamtkgfrwivgmqssnggwgay
    dvdntsdlpnhipfsdfgevtdppsedvtahvlecfgsfgyddawkvirraveylkreqk
    pdgswfgrwgvnylygtgavvsalkavgidtrepyiqkaldwveqhqnpdggwgedcrsy
    edpayagkgastpsqtawalmaliaggraeseaarrgvqylvetqrpdggwdepyytgtg
    fpgdfylgytmyrhvfptlalgrykqaierr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2sqcA (A:)
    apayartldraveyllscqkdegywwgpllsnvtmeaeyvllchildrvdrdrmekirry
    llheqredgtwalypggppdldttieayvalkyigmsrdeepmqkalrfiqsqggiessr
    vftrmwlalvgeypwekvpmvppeimflgkrmplniyefgswaratvvalsivmsrqpvf
    plperarvpelyetdvpprrrgakggggwifdaldralhgyqklsvhpfrraaeiraldw
    llerqagdgswggiqppwfyalialkildmtqhpafikgweglelygveldyggwmfqas
    ispvwdtglavlalraaglpadhdrlvkagewlldrqitvpgdwavkrpnlkpggfafqf
    dnvyypdvcdtavvvwalntlrlpderrrrdamtkgfrwivgmqssnggwgaydvdntsd
    lpnhipfsdfgevtdppsedvtahvlecfgsfgyddawkvirraveylkreqkpdgswfg
    rwgvnylygtgavvsalkavgidtrepyiqkaldwveqhqnpdggwgedcrsyedpayag
    kgastpsqtawalmaliaggraeseaarrgvqylvetqrpdggwdepyytgtgfpgdfyl
    gytmyrhvfptlalgrykqaier
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2sqcB (B:)
    maeqlveapayartldraveyllscqkdegywwgpllsnvtmeaeyvllchildrvdrdr
    mekirryllheqredgtwalypggppdldttieayvalkyigmsrdeepmqkalrfiqsq
    ggiessrvftrmwlalvgeypwekvpmvppeimflgkrmplniyefgswaratvvalsiv
    msrqpvfplperarvpelyetdvpprrrgakggggwifdaldralhgyqklsvhpfrraa
    eiraldwllerqagdgswggiqppwfyalialkildmtqhpafikgweglelygveldyg
    gwmfqasispvwdtglavlalraaglpadhdrlvkagewlldrqitvpgdwavkrpnlkp
    ggfafqfdnvyypdvcdtavvvwalntlrlpderrrrdamtkgfrwivgmqssnggwgay
    dvdntsdlpnhipfsdfgevtdppsedvtahvlecfgsfgyddawkvirraveylkreqk
    pdgswfgrwgvnylygtgavvsalkavgidtrepyiqkaldwveqhqnpdggwgedcrsy
    edpayagkgastpsqtawalmaliaggraeseaarrgvqylvetqrpdggwdepyytgtg
    fpgdfylgytmyrhvfptlalgrykqaierr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2sqcB (B:)
    apayartldraveyllscqkdegywwgpllsnvtmeaeyvllchildrvdrdrmekirry
    llheqredgtwalypggppdldttieayvalkyigmsrdeepmqkalrfiqsqggiessr
    vftrmwlalvgeypwekvpmvppeimflgkrmplniyefgswaratvvalsivmsrqpvf
    plperarvpelyetdvpprrrgakggggwifdaldralhgyqklsvhpfrraaeiraldw
    llerqagdgswggiqppwfyalialkildmtqhpafikgweglelygveldyggwmfqas
    ispvwdtglavlalraaglpadhdrlvkagewlldrqitvpgdwavkrpnlkpggfafqf
    dnvyypdvcdtavvvwalntlrlpderrrrdamtkgfrwivgmqssnggwgaydvdntsd
    lpnhipfsdfgevtdppsedvtahvlecfgsfgyddawkvirraveylkreqkpdgswfg
    rwgvnylygtgavvsalkavgidtrepyiqkaldwveqhqnpdggwgedcrsyedpayag
    kgastpsqtawalmaliaggraeseaarrgvqylvetqrpdggwdepyytgtgfpgdfyl
    gytmyrhvfptlalgrykqaier