PDB entry 2spt

View 2spt on RCSB PDB site
Description: differences in the metal ion structure between sr-and ca-prothrombin fragment 1
Deposited on 1994-02-01, released 1994-05-31
The last revision prior to the SCOP 1.67 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.167
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2spt_ (-)
    ankgfleevrkgnlerecleepcsreeafealeslsatdafwakytacesarnpreklne
    clegncaegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdg
    sitgpwcyttsptlrreecsvpvcg