PDB entry 2spo

View 2spo on RCSB PDB site
Description: a novel site-directed mutant of myoglobin with an unusually high o2 affinity and low autooxidation rate
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1993-08-25, released 1994-01-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.157
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • conflict (29)
      • conflict (122)
    Domains in SCOPe 2.03: d2spoa_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2spoA (A:)
    mvlsegewqlvlhvwakveadvaghgqdivirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg