PDB entry 2spc

View 2spc on RCSB PDB site
Description: crystal structure of the repetitive segments of spectrin
Deposited on 1994-03-01, released 1994-05-31
The last revision prior to the SCOP 1.71 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d2spca_
  • Chain 'B':
    Domains in SCOP 1.71: d2spcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2spcA (A:)
    qnldlqlymrdcelaeswmsareaflnadddanaggnvealikkhedfdkaingheqkia
    alqtvadqliaqnhyasnlvdekrkqvlerwrhlkegliekrsrlgd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2spcB (B:)
    qnldlqlymrdcelaeswmsareaflnadddanaggnvealikkhedfdkaingheqkia
    alqtvadqliaqnhyasnlvdekrkqvlerwrhlkegliekrsrlgd