PDB entry 2sob

View 2sob on RCSB PDB site
Description: sn-ob, ob-fold sub-domain of staphylococcal nuclease, nmr, 10 structures
Class: hydrolase (phosphoric diester)
Keywords: hydrolase (phosphoric diester)
Deposited on 1995-09-15, released 1995-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: STAPHYLOCOCCAL NUCLEASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-102)
      • engineered (65)
      • engineered (87)
    Domains in SCOPe 2.05: d2soba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sobA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmlenakkievefdkgqrtdkygrvlayiyadgkmvneal