PDB entry 2sob

View 2sob on RCSB PDB site
Description: sn-ob, ob-fold sub-domain of staphylococcal nuclease, nmr, 10 structures
Class: hydrolase (phosphoric diester)
Keywords: hydrolase (phosphoric diester)
Deposited on 1995-09-15, released 1995-12-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: staphylococcal nuclease
  Species: Staphylococcus aureus
  Gene: STAPHYLOCOCCAL NUCLEASE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00644 (0-102)
    • engineered (65)
    • engineered (87)
  Domains in SCOP 1.73: d2soba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sobA (A:)
  atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
  ftkkmlenakkievefdkgqrtdkygrvlayiyadgkmvneal