PDB entry 2snv

View 2snv on RCSB PDB site
Description:
Deposited on 1992-07-17, released 1993-10-31
The last revision prior to the SCOP 1.65 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2snv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2snv_ (-)
    rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
    rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
    adegtrtalsvvtwnskgktikttpegteew