PDB entry 2sns

View 2sns on RCSB PDB site
Description: staphylococcal nuclease. proposed mechanism of action based on structure of enzyme-thymidine 3(prime),5(prime)-biphosphate-calcium ion complex at 1.5-angstroms resolution
Deposited on 1982-05-14, released 1982-07-29
The last revision prior to the SCOP 1.55 freeze date was dated 1995-03-08, with a file datestamp of 1995-03-23.
Experiment type: -
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2sns__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sns_ (-)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefnkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniws