PDB entry 2sns

View 2sns on RCSB PDB site
Description: staphylococcal nuclease. proposed mechanism of action based on structure of enzyme-thymidine 3(prime),5(prime)-biphosphate-calcium ion complex at 1.5-angstroms resolution
Class: hydrolase (phosphoric diester)
Keywords: hydrolase (phosphoric diester)
Deposited on 1982-05-14, released 1982-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thermonuclease precursor
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-End)
      • conflict (76)
    Domains in SCOPe 2.08: d2snsa_
  • Heterogens: CA, THP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2snsA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefnkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsendadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2snsA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefnkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniws