PDB entry 2snm

View 2snm on RCSB PDB site
Description: in a staphylococcal nuclease mutant the side-chain of a lysine replacing valine 66 is fully buried in the hydrophobic core
Class: hydrolase (phosphoric diester)
Keywords: hydrolase (phosphoric diester)
Deposited on 1991-04-03, released 1993-01-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.183
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • conflict (65)
    Domains in SCOPe 2.02: d2snma_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2snmA (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmkenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
heqhlrkseaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >2snmA (A:)
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmk
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kseaqakkeklniws