PDB entry 2sn3

View 2sn3 on RCSB PDB site
Description: structure of scorpion toxin variant-3 at 1.2 angstroms resolution
Class: toxin
Keywords: toxin
Deposited on 1992-02-20, released 1994-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.192
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: scorpion neurotoxin (variant 3)
    Species: Centruroides exilicauda [TaxId:6879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2sn3a_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sn3A (A:)
    kegylvkksdgckygclklgenegcdteckaknqggsygycyafacwceglpestptypl
    pnksc