PDB entry 2sli

View 2sli on RCSB PDB site
Description: leech intramolecular trans-sialidase complexed with 2,7-anhydro-neu5ac, the reaction product
Deposited on 1998-10-03, released 1999-04-27
The last revision prior to the SCOP 1.57 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sli_ (-)
    ipegilmeknnvdiaegqgysldqeagakyvkamtqgtiilsykstsengiqslfsvgns
    tagnqdrhfhiyitnsggigielrntdgvfnytldrpasvralykgervfntvalkadaa
    nkqcrlfangellatldkdafkfisditgvdnvtlggtkrqgkiaypfggtigdikvysn
    alsdeeliqatgvttygenifyagdvtesnyfripslltlstgtvisaadaryggthdsk
    skiniafakstdggntwseptlplkfddyiaknidwprdsvgknvqiqgsasyidpvlle
    dkltkriflfadlmpagigssnasvgsgfkevngkkylklrwhkdagraydytirekgvi
    yndatnqptefrvdgeynlyqhdtnltckqydynfsgnnliesktdvdvnmnifyknsvf
    kafptnylamrysddegaswsdldivssfkpevskflvvgpgigkqistgenagrllvpl
    yskssaelgfmysddhgdnwtyveadnltggataeaqivempdgslktylrtgsnciaev
    tsidggetwsdrvplqgisttsygtqlsvinysqpidgkpaiilsspnatngrkngkiwi
    glvndtgntgidkysvewkysyavdtpqmgysysclaelpdgqvgllyekydswsrnelh
    lkdilkfekysiseltgqa