PDB entry 2skd

View 2skd on RCSB PDB site
Description: pyridoxal phosphorylase b in complex with phosphate, glucose and inosine-5'-monophosphate
Class: transferase
Keywords: glycogen phosphorylase, glycogen metabolism, allosteric enzyme, pyridoxal phosphate, transferase
Deposited on 1998-12-11, released 1998-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.167
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyridoxal phosphorylase b
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489 (Start-841)
      • see remark 999 (608)
    Domains in SCOPe 2.07: d2skda_
  • Heterogens: GLC, PO4, PLP, IMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2skdA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2skdA (A:)
    isvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtqq
    hyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedaglg
    ngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpweka
    rpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapndf
    nlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfk
    sskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktc
    aytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslve
    egavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwl
    vlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylere
    ykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapg
    yhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagte
    asgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyy
    dripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyk
    nprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdekip