PDB entry 2siv
View 2siv on RCSB PDB site
Description: siv gp41 core structure
Class: envelope glycoprotein
Keywords: envelope glycoprotein, retrovirus, hiv, siv, gp41, coat protein
Deposited on
1998-06-17, released
1998-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: siv gp41 glycoprotein
Species: Simian immunodeficiency virus [TaxId:11723]
Gene: GP41
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2siv.1 - Chain 'B':
Compound: siv gp41 glycoprotein
Species: Simian immunodeficiency virus [TaxId:11723]
Gene: GP41
Database cross-references and differences (RAF-indexed):
- Uniprot Q87973 (0-33)
- conflict (6)
- conflict (12)
- conflict (16)
Domains in SCOPe 2.08: d2siv.1 - Chain 'C':
Compound: siv gp41 glycoprotein
Species: Simian immunodeficiency virus [TaxId:11723]
Gene: GP41
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2siv.2 - Chain 'D':
Compound: siv gp41 glycoprotein
Species: Simian immunodeficiency virus [TaxId:11723]
Gene: GP41
Database cross-references and differences (RAF-indexed):
- Uniprot Q87973 (0-33)
- conflict (6)
- conflict (12)
- conflict (16)
Domains in SCOPe 2.08: d2siv.2 - Chain 'E':
Compound: siv gp41 glycoprotein
Species: Simian immunodeficiency virus [TaxId:11723]
Gene: GP41
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2siv.3 - Chain 'F':
Compound: siv gp41 glycoprotein
Species: Simian immunodeficiency virus [TaxId:11723]
Gene: GP41
Database cross-references and differences (RAF-indexed):
- Uniprot Q87973 (0-33)
- conflict (6)
- conflict (12)
- conflict (16)
Domains in SCOPe 2.08: d2siv.3 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2sivA (A:)
agivqqqqqlldvvkrqqellrltvwgtknlqtrvt
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2sivB (B:)
wqewerkvdfleenitalleeaqiqqeknmyelq
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2sivC (C:)
agivqqqqqlldvvkrqqellrltvwgtknlqtrvt
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>2sivD (D:)
wqewerkvdfleenitalleeaqiqqeknmyelq
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>2sivE (E:)
agivqqqqqlldvvkrqqellrltvwgtknlqtrvt
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>2sivF (F:)
wqewerkvdfleenitalleeaqiqqeknmyelq