PDB entry 2siv

View 2siv on RCSB PDB site
Description: siv gp41 core structure
Class: envelope glycoprotein
Keywords: envelope glycoprotein, retrovirus, hiv, siv, gp41, coat protein
Deposited on 1998-06-17, released 1998-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: siv gp41 glycoprotein
  Species: Simian immunodeficiency virus [TaxId:11723]
  Gene: GP41
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q87973 (0-35)
  Domains in SCOPe 2.08: d2siv.1
• Chain 'B':
  Compound: siv gp41 glycoprotein
  Species: Simian immunodeficiency virus [TaxId:11723]
  Gene: GP41
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q87973 (0-33)
    • conflict (6)
    • conflict (12)
    • conflict (16)
  Domains in SCOPe 2.08: d2siv.1
• Chain 'C':
  Compound: siv gp41 glycoprotein
  Species: Simian immunodeficiency virus [TaxId:11723]
  Gene: GP41
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q87973 (0-35)
  Domains in SCOPe 2.08: d2siv.2
• Chain 'D':
  Compound: siv gp41 glycoprotein
  Species: Simian immunodeficiency virus [TaxId:11723]
  Gene: GP41
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q87973 (0-33)
    • conflict (6)
    • conflict (12)
    • conflict (16)
  Domains in SCOPe 2.08: d2siv.2
• Chain 'E':
  Compound: siv gp41 glycoprotein
  Species: Simian immunodeficiency virus [TaxId:11723]
  Gene: GP41
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q87973 (0-35)
  Domains in SCOPe 2.08: d2siv.3
• Chain 'F':
  Compound: siv gp41 glycoprotein
  Species: Simian immunodeficiency virus [TaxId:11723]
  Gene: GP41
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q87973 (0-33)
    • conflict (6)
    • conflict (12)
    • conflict (16)
  Domains in SCOPe 2.08: d2siv.3
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sivA (A:)
  agivqqqqqlldvvkrqqellrltvwgtknlqtrvt
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sivB (B:)
  wqewerkvdfleenitalleeaqiqqeknmyelq
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sivC (C:)
  agivqqqqqlldvvkrqqellrltvwgtknlqtrvt
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sivD (D:)
  wqewerkvdfleenitalleeaqiqqeknmyelq
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sivE (E:)
  agivqqqqqlldvvkrqqellrltvwgtknlqtrvt
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sivF (F:)
  wqewerkvdfleenitalleeaqiqqeknmyelq