PDB entry 2sim

View 2sim on RCSB PDB site
Description: the structures of salmonella typhimurium lt2 neuraminidase and its complex with a transition state analogue at 1.6 angstroms resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 1994-07-15, released 1994-11-30
The last revision prior to the SCOP 1.75 freeze date was dated 1994-11-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.185
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: SALMONELLA TYPHIMURIUM
    Gene: PSX62
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29768 (0-380)
      • conflict (327)
    Domains in SCOP 1.75: d2sima_
  • Heterogens: DAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2simA (A:)
    tveksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntas
    dqsfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkw
    nnndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsg
    lqlndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnasl
    vnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaq
    nknndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvye
    angsiefqdlsrhlpviksyn