PDB entry 2sim

View 2sim on RCSB PDB site
Description: the structures of salmonella typhimurium lt2 neuraminidase and its complex with a transition state analogue at 1.6 angstroms resolution
Deposited on 1994-07-15, released 1994-11-30
The last revision prior to the SCOP 1.69 freeze date was dated 1994-11-30, with a file datestamp of 1994-12-07.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.185
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d2sim__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sim_ (-)
    tveksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntas
    dqsfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkw
    nnndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsg
    lqlndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnasl
    vnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaq
    nknndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvye
    angsiefqdlsrhlpviksyn