PDB entry 2sil

View 2sil on RCSB PDB site
Description: the structures of salmonella typhimurium lt2 neuraminidase and its complex with a transition state analogue at 1.6 angstroms resolution
Deposited on 1994-07-13, released 1994-08-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.166
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2sil__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sil_ (-)
    tveksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntas
    dqsfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkw
    nnndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsg
    lqlndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnasl
    vnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaq
    nknndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvye
    angsiefqdlsrhlpviksyn