PDB entry 2sh1

View 2sh1 on RCSB PDB site
Description: solution structure of neurotoxin I from the sea anemone stichodactyla helianthus. a nuclear magnetic resonance, distance geometry and restrained molecular dynamics study
Class: neurotoxin
Keywords: neurotoxin
Deposited on 1990-05-03, released 1991-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neurotoxin I
    Species: Stichodactyla helianthus [TaxId:6123]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2sh1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sh1A (A:)
    aackcddegpdirtapltgtvdlgscnagwekcasyytiiadccrkkk