PDB entry 2sgf

View 2sgf on RCSB PDB site
Description: phe 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Deposited on 1999-03-25, released 2003-08-26
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-26, with a file datestamp of 2003-08-26.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.67: d2sgfe_
  • Chain 'I':
    Domains in SCOP 1.67: d2sgfi_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sgfE (E:)
    isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
    nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
    gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
    gvsvy
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sgfI (I:)
    vdcseypkpactfeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc