PDB entry 2sga

View 2sga on RCSB PDB site
Description: electron density calculations as an extension of protein structure refinement. streptomyces griseus protease at 1.5 angstroms resolution
Deposited on 1983-01-21, released 1983-04-21
The last revision prior to the SCOP 1.59 freeze date was dated 1989-01-09, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.126
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2sga__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sga_ (-)
    iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
    hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
    ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
    l