PDB entry 2sga

View 2sga on RCSB PDB site
Description: electron density calculations as an extension of protein structure refinement. streptomyces griseus protease at 1.5 angstroms resolution
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1983-01-21, released 1983-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.126
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteinase a
    Species: Streptomyces griseus [TaxId:1911]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00776 (0-180)
      • conflict (131)
    Domains in SCOPe 2.08: d2sgaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sgaA (A:)
    iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
    hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
    ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
    l