PDB entry 2sfa

View 2sfa on RCSB PDB site
Description: serine proteinase from streptomyces fradiae atcc 14544
Deposited on 1994-04-25, released 1996-06-20
The last revision prior to the SCOP 1.57 freeze date was dated 1996-06-20, with a file datestamp of 1996-06-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.182
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2sfa__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sfa_ (-)
    iaggeaiyaagggrcslgfnvrsssgatyaltaghcteiastwytnsgqtsllgtragts
    fpgndyglirhsnasaadgrvylyngsyrditgagnayvgqtvqrsgsttglhsgrvtgl
    natvnygggdivsgliqtnvcaepgdsggalfagstalgltsggsgncrtggttffqpvt
    ealsaygvsil