PDB entry 2sdf

View 2sdf on RCSB PDB site
Description: solution nmr structure of stromal cell-derived factor-1 (sdf-1), 30 structures
Class: cytokine
Keywords: cytokine, sdf-1, chemokines, stromal cell-derived factor-1, g-coupled receptors, protein synthesis, solution structure
Deposited on 1998-03-07, released 1998-06-17
The last revision prior to the SCOP 1.73 freeze date was dated 1998-06-17, with a file datestamp of 2007-06-04.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: stromal cell-derived factor-1
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48061 (0-66)
  Domains in SCOP 1.73: d2sdfa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sdfA (A:)
  kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
  ylekaln