PDB entry 2sdf

View 2sdf on RCSB PDB site
Description: solution nmr structure of stromal cell-derived factor-1 (sdf-1), 30 structures
Deposited on 1998-03-07, released 1998-06-17
The last revision prior to the SCOP 1.71 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d2sdf__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sdf_ (-)
  kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
  ylekaln