PDB entry 2sdf

View 2sdf on RCSB PDB site
Description: solution nmr structure of stromal cell-derived factor-1 (sdf-1), 30 structures
Class: cytokine
Keywords: cytokine, sdf-1, chemokines, stromal cell-derived factor-1, g-coupled receptors, protein synthesis, solution structure
Deposited on 1998-03-07, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stromal cell-derived factor-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2sdfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sdfA (A:)
    kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
    ylekaln