PDB entry 2scu

View 2scu on RCSB PDB site
Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli
Class: ligase
Keywords: citric acid cycle, heterotetramer, ligase
Deposited on 1998-09-24, released 1999-08-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (succinyl-coa ligase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07459 (0-End)
      • modified residue (245)
    Domains in SCOPe 2.03: d2scua1, d2scua2
  • Chain 'B':
    Compound: protein (succinyl-coa ligase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2scub1, d2scub2
  • Chain 'D':
    Compound: protein (succinyl-coa ligase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07459 (0-End)
      • modified residue (245)
    Domains in SCOPe 2.03: d2scud1, d2scud2
  • Chain 'E':
    Compound: protein (succinyl-coa ligase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2scue1, d2scue2
  • Heterogens: SO4, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2scuA (A:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2scuA (A:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2scuB (B:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaavegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2scuB (B:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2scuD (D:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2scuD (D:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2scuE (E:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaavegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2scuE (E:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaav