PDB entry 2scp

View 2scp on RCSB PDB site
Description: structure of a sarcoplasmic calcium-binding protein from nereis diversicolor refined at 2.0 angstroms resolution
Deposited on 1991-08-22, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d2scpa_
  • Chain 'B':
    Domains in SCOP 1.61: d2scpb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2scpA (A:)
    sdlwvqkmktyfnridfdkdgaitrmdfesmaerfakesemkaehakvlmdsltgvwdnf
    ltavaggkgidettfinsmkemvknpeaksvvegplplffravdtnednnisrdeygiff
    gmlgldktmapasfdaidtnndgllsleefviagsdffmndgdstnkvfwgplv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2scpB (B:)
    sdlwvqkmktyfnridfdkdgaitrmdfesmaerfakesemkaehakvlmdsltgvwdnf
    ltavaggkgidettfinsmkemvknpeaksvvegplplffravdtnednnisrdeygiff
    gmlgldktmapasfdaidtnndgllsleefviagsdffmndgdstnkvfwgplv