PDB entry 2sbt

View 2sbt on RCSB PDB site
Description: a comparison of the three-dimensional structures of subtilisin bpn and subtilisin novo
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1976-09-07, released 1976-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin novo
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00782 (0-274)
      • conflict (55-56)
      • conflict (60)
      • conflict (87-88)
      • conflict (97-98)
      • conflict (157-158)
      • conflict (250)
    Domains in SCOPe 2.08: d2sbta_
  • Heterogens: ACN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sbtA (A:)
    aqsvpygvsqikapalhsqgytgsnvkvavidsgidsshpdlkvaggasmvpsetpnfqd
    dnshgthvagtvaalnnsigvlgvapssalyavkvlgdagsgqyswiingiewaiannmd
    vinmslggpsgsaalkaavdkavasgvvvvaaagnegstgssstvgypgkypsviavgav
    dssnqrasfssvgpeldvmapgvsiqstlpgnkygayngtsmasphvagaaalilskhpn
    wtntqvrsslqntttklgdsfyygkglinvqaaaq