PDB entry 2sbl

View 2sbl on RCSB PDB site
Description: the three-dimensional structure of an arachidonic acid 15-lipoxygenase
Deposited on 1993-07-22, released 1995-02-27
The last revision prior to the SCOP 1.57 freeze date was dated 1995-03-03, with a file datestamp of 1995-03-16.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.173
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    Domains in SCOP 1.57: d2sblb1, d2sblb2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2sblB (B:)
    kikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfleg
    intslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfv
    cnswvyntklyksvriffanhtyvpsetpaplvsyreeelkslrgngtgerkeydriydy
    dvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenl
    ghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvist
    iiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefp
    pksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsa
    ktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwllakayv
    ivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmninalarqsl
    inangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphgvrllie
    dypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpww
    pklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgtpeyeem
    innhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfg
    nklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2sblB (B:)
    kikgtvvlmpknelelnaflgrsvslqlisatkadahgkgkvgkdtfleginlgagesaf
    nihfewdgsmgipgafyiknymqvefflksltleaitirfvcnswvyntklyksvriffa
    nhtyvpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpv
    lggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqi
    vqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhil
    kfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskita
    dsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkp
    vaielslpaavsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamepfvi
    athrhlsvlhpiyklltphyrnnmninalarqslinangiiettflpskysvemssavyk
    nwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyvply
    yardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasalhaa
    vnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlislsvie
    ilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnrlgp
    vqlpytllypsseegltfrgipnsisi