PDB entry 2sbl

View 2sbl on RCSB PDB site
Description: the three-dimensional structure of an arachidonic acid 15-lipoxygenase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1993-07-22, released 1995-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.173
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2sbla1, d2sbla2
  • Chain 'B':
    Compound: lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2sblb1, d2sblb2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2sblA (A:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplvsyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2sblA (A:)
    kikgtvvlmpknelelnaflgrsvslqlisatkadahgkgkvgkdtfleginlgagesaf
    nihfewdgsmgipgafyiknymqvefflksltleaitirfvcnswvyntklyksvriffa
    nhtyvpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpv
    lggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqi
    vqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhil
    kfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskita
    dsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkp
    vaielslpaavsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamepfvi
    athrhlsvlhpiyklltphyrnnmninalarqslinangiiettflpskysvemssavyk
    nwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyvply
    yardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasalhaa
    vnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlislsvie
    ilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnrlgp
    vqlpytllypsseegltfrgipnsisi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2sblB (B:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplvsyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2sblB (B:)
    kikgtvvlmpknelelnaflgrsvslqlisatkadahgkgkvgkdtfleginlgagesaf
    nihfewdgsmgipgafyiknymqvefflksltleaitirfvcnswvyntklyksvriffa
    nhtyvpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpv
    lggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqi
    vqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhil
    kfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskita
    dsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkp
    vaielslpaavsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamepfvi
    athrhlsvlhpiyklltphyrnnmninalarqslinangiiettflpskysvemssavyk
    nwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyvply
    yardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasalhaa
    vnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlislsvie
    ilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnrlgp
    vqlpytllypsseegltfrgipnsisi