PDB entry 2sba

View 2sba on RCSB PDB site
Description: soybean agglutinin complexed with 2,6-pentasaccharide
Deposited on 1998-12-03, released 1998-12-09
The last revision prior to the SCOP 1.69 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.208
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d2sbaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2sbaA (A:)
    aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
    dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqv
    vavefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslv
    ypsqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlphassnid
    pldltsfvlheai
    

    Sequence, based on observed residues (ATOM records): (download)
    >2sbaA (A:)
    aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
    dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnendqvvav
    efdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslvyps
    qrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlpha