PDB entry 2sas

View 2sas on RCSB PDB site
Description: structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 angstroms resolution
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1993-07-30, released 1993-10-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.199
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sarcoplasmic calcium-binding protein
  Species: Branchiostoma lanceolatum [TaxId:7740]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04570 (0-184)
  Domains in SCOPe 2.02: d2sasa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sasA (A:)
  glndfqkqkikftfdffldmnhdgsiqdndfedmmtrykevnkgslsdadyksmqasled
  ewrdlkgradinkddvvsweeylamwektiatcksvadlpawcqnripflfkgmdvsgdg
  ivdleefqnycknfqlqcadvpavynvitdggkvtfdlnrykelyyrlltspaadagntl
  mgqkp