PDB entry 2sas

View 2sas on RCSB PDB site
Description: structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 angstroms resolution
Deposited on 1993-07-30, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2sas__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sas_ (-)
    glndfqkqkikftfdffldmnhdgsiqdndfedmmtrykevnkgslsdadyksmqasled
    ewrdlkgradinkddvvsweeylamwektiatcksvadlpawcqnripflfkgmdvsgdg
    ivdleefqnycknfqlqcadvpavynvitdggkvtfdlnrykelyyrlltspaadagntl
    mgqkp