PDB entry 2sar
View 2sar on RCSB PDB site
Description: determination and restrained least-squares refinement of the crystal structures of ribonuclease sa and its complex with 3'-guanylic acid at 1.8 angstroms resolution
Class: hydrolase (endoribonuclease)
Keywords: hydrolase (endoribonuclease)
Deposited on
1990-12-13, released
1992-04-15
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ribonuclease sa
Species: Streptomyces aureofaciens [TaxId:1894]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2sara_ - Chain 'B':
Compound: ribonuclease sa
Species: Streptomyces aureofaciens [TaxId:1894]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2sarb_ - Heterogens: SO4, 3GP, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2sarA (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2sarB (B:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc