PDB entry 2sar

View 2sar on RCSB PDB site
Description: determination and restrained least-squares refinement of the crystal structures of ribonuclease sa and its complex with 3'-guanylic acid at 1.8 angstroms resolution
Class: hydrolase (endoribonuclease)
Keywords: hydrolase (endoribonuclease)
Deposited on 1990-12-13, released 1992-04-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease sa
  Species: Streptomyces aureofaciens [TaxId:1894]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
  Domains in SCOPe 2.05: d2sara_
• Chain 'B':
  Compound: ribonuclease sa
  Species: Streptomyces aureofaciens [TaxId:1894]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
  Domains in SCOPe 2.05: d2sarb_
• Heterogens: SO4, 3GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sarA (A:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
  gartrgtrriicgeatqedyytgdhyatfslidqtc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sarB (B:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
  gartrgtrriicgeatqedyytgdhyatfslidqtc